PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family BBR-BPC
Protein Properties Length: 415aa    MW: 45449.6 Da    PI: 10.2505
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018324.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind336.95.2e-103724151301
   GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia.erdaki.........rernlalsekkaavaerd..................maflqrdkalaer 70 
                 mdddgs   rn+g+y+p    k++lglqlmss++ +rd+k          ++ +++  ++ +++++rd                  m+f +++++l+  
  Do018324.1  72 MDDDGSLGiRNWGFYDPV---KSDLGLQLMSSMPaDRDTKSllpagaflqQHGHHNAPHQLHSHHSRDsngggasggmptephsihMDFSRNEAWLHP- 166
                 9*****999*******99...99**********99******9******98666777788889999*********************************. PP

   GAGA_bind  71 nkalverdnkllalllvensla.................salpvgvqvlsgt.ksidslqqlsepqledsavelreeeklealpieeaaeeake...kk 148
                  ++ ++r++k+l+  +v  +                   +++p+g+++++++ ++++++q + ++ql++++    +e+ +  l +e++  +++e   kk
  Do018324.1 167 SHHQHPREQKVLHARPVGPAGHvghprhgghpgngghavHHHPTGYGMMPDApHTLQMMQPQLQSQLQEPPPC--KEDGVPPLLVEDHSVVKTEppvKK 263
                 9999***********999887788999************9*********998255677777888999988765..344444444444444444411123 PP

   GAGA_bind 149 kkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvs 247
                 +++ rq+ ++pk++k kk+kk  ++++++ + +++ +r + +kk++++v+ng++lD s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP++
  Do018324.1 264 RQQGRQQDRQPKSPKPKKPKK-AAVPREDGTINGHAPRGRGPKKTVGMVINGIELDLSNIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMN 361
                 334457889999999999999.88999*******99*************************************************************** PP

   GAGA_bind 248 tkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                 tkrrgaRiagrKmSqgafkk+LekL +eGy+lsnp+DLk++WAkHGtnkfv ir
  Do018324.1 362 TKRRGARIAGRKMSQGAFKKVLEKLVGEGYNLSNPIDLKTFWAKHGTNKFVIIR 415
                 ****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062172.7E-11672415IPR010409GAGA-binding transcriptional activator
SMARTSM012266.6E-18472415IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
LLQPRPRLSF LAATTGRAAA PFAGPFASDE HPTEWVVQGL VIGGQFRRWA DQSHSRFGFL  60
LPVDLLIPQS EMDDDGSLGI RNWGFYDPVK SDLGLQLMSS MPADRDTKSL LPAGAFLQQH  120
GHHNAPHQLH SHHSRDSNGG GASGGMPTEP HSIHMDFSRN EAWLHPSHHQ HPREQKVLHA  180
RPVGPAGHVG HPRHGGHPGN GGHAVHHHPT GYGMMPDAPH TLQMMQPQLQ SQLQEPPPCK  240
EDGVPPLLVE DHSVVKTEPP VKKRQQGRQQ DRQPKSPKPK KPKKAAVPRE DGTINGHAPR  300
GRGPKKTVGM VINGIELDLS NIPTPVCSCT GAPQQCYRWG AGGWQSACCT TSISTYPLPM  360
NTKRRGARIA GRKMSQGAFK KVLEKLVGEG YNLSNPIDLK TFWAKHGTNK FVIIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699427.10.0PREDICTED: protein Barley B recombinant-like
RefseqXP_004956022.10.0PREDICTED: protein Barley B recombinant-like
SwissprotQ8GUC31e-146BBR_HORVU; Protein Barley B recombinant
TrEMBLK3ZSA00.0K3ZSA0_SETIT; Uncharacterized protein
STRINGSi029480m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.35e-60basic pentacysteine 2